PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06188.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 965aa    MW: 106779 Da    PI: 5.869
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06188.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.28.1e-29600650252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 e+++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  KHN06188.1 600 ENNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 650
                 689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154582670IPR003035RWP-RK domain
PfamPF020422.5E-26602650IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2408.6E-23862944No hitNo description
SuperFamilySSF542774.91E-21862949No hitNo description
SMARTSM006663.1E-22865947IPR000270PB1 domain
PROSITE profilePS5174523.064865947IPR000270PB1 domain
CDDcd064074.31E-30866946No hitNo description
PfamPF005642.7E-17868946IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 965 aa     Download sequence    Send to blast
MEDHVSPEGK EVSCCTPPGA QLEEPTSVDG GMKKSASEDM FSNFSELMNF DTYAGWSNSP  60
SMTDQSLANV FSSFSLAPYP VPDVLNLVEH GNGPFFMTED SEIHNDMESA PSCGERIIFQ  120
QMDFQLGFLD EANDSNSLDS KQKPNGTSQE VNTTDMCNYI ISSSPGRSLD DRMLRALSFF  180
MESADGGMLA QVWVPIKHGD EFILSTSEQP YLLDPKLAGY REVSRAFTFS AEGKTQSCPG  240
LPARVFISHV PEWTSNVGYY NKTEYLRLEH ARNHEIRGSI ALPISDVHSQ VPCAVLELVT  300
TKEKPNFDRE LEIVSQALQL VNLRTTMPPR LHPQCLSSNK RAALTEIIDV LRAVCHAHRL  360
PLALTWIPCC YSEGIRNETD RIRIKEGHTS PNEKCVLCIE ESACYVNDGA VEGFVHACVE  420
HHLEEGQGIA GKALQSNHPF FYTDVKTYDI GEYPLVHHAR KYNLNAAVAI RLRSTYTNDD  480
DYILEFFLPV NMTGSSEQEL LLDNLSSTMR RICKSLRTVS DAELTGIEGS QGGFPKEKVS  540
GFFPMSRRNS QIAFISDDHD SVLKMSLKAS NMRNNGIEAV HSQTMNGSRK QVEKKRSTVE  600
NNVSLSVLQQ YFSGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLKKIQTV  660
LDSVQGVEGG LKFDPYTGGF IAGGSIMQET EAHKYLVFPE KSSVKDPKPA TQKKVSVAPA  720
PASTIENSTI KLNDDEGVCL VGNKLVHSRS IPNSNSGEGE LKKDNVSSDD SKSMTMNDGS  780
CHKACHWKKT KDCPEQTCSM SLVTDEVEVG VDRVEGADEH NHPTSSSTTN SSNGSGSMMH  840
GSSSCSHENQ KYSKVKSNCV DSGSKMIVKA SYRGDTIRFK FDPSSGCFQL YKEVATRFKL  900
QNGSFQLKYL DDEEEWVMLV NDSDLQECTE ILDDIGTRCV KFLVRDVPCV LSSHGSNSCF  960
LSDSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351720.0AC235172.1 Glycine max strain Williams 82 clone GM_WBb0002N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539038.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A0B2PEY20.0A0A0B2PEY2_GLYSO; Protein NLP8
TrEMBLK7LPE40.0K7LPE4_SOYBN; Uncharacterized protein
STRINGGLYMA11G13390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]